PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID XP_009148049.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Brassicaceae; Brassiceae; Brassica
Family GATA
Protein Properties Length: 282aa    MW: 31773.5 Da    PI: 9.0057
Description GATA family protein
Gene Model
Gene Model ID Type Source Coding Sequence
XP_009148049.1genomeNCBIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1GATA64.21.4e-20208242135
            GATA   1 CsnCgttkTplWRrgpdgnktLCnaCGlyyrkkgl 35 
                     C++C ttkTp+WR+gp+g+ktLCnaCG+++r+ +l
  XP_009148049.1 208 CTHCETTKTPQWREGPNGPKTLCNACGVRFRSGRL 242
                     *******************************9885 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SuperFamilySSF577161.28E-15201264No hitNo description
SMARTSM004013.8E-20202252IPR000679Zinc finger, GATA-type
PROSITE profilePS5011412.084206238IPR000679Zinc finger, GATA-type
Gene3DG3DSA:3.30.50.101.9E-15206239IPR013088Zinc finger, NHR/GATA-type
CDDcd002022.80E-17207256No hitNo description
PfamPF003202.3E-18208242IPR000679Zinc finger, GATA-type
PROSITE patternPS003440208233IPR000679Zinc finger, GATA-type
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
GO:0008270Molecular Functionzinc ion binding
GO:0043565Molecular Functionsequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 282 aa     Download sequence    Send to blast
MNWLPEEEFK GLSDNFFDDF INHIDFPLED IDTTNGEGDW DAKFKELEPP PMDMFTTFPS  60
EFNSCGVASK DGIKKNVSVL KQSDASAALS GINNTLHQSS SHHDVKVSKL FQSSSPVSVL  120
ESSDGSFSPQ NSTSQRLTFP VKGLRSKRKR PTTLRRRHLY PFKPEKLTPE ELESSEQHAK  180
KKRKIFTTNH TVSSSSEGLN SDGVVRRCTH CETTKTPQWR EGPNGPKTLC NACGVRFRSG  240
RLVPEYRPAS SPTFIPSVHS NSHRKIIEMR SREGDQFDKR AV
Expression -- UniGene ? help Back to Top
UniGene ID E-value Expressed in
Bra.130450.0bud| flower| silique
Binding Motif ? help Back to Top
Motif ID Method Source Motif file
MP00130DAPTransfer from AT1G08010Download
Motif logo
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieveRetrieve
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAC1895186e-75AC189518.2 Brassica rapa subsp. pekinensis cultivar Inbred line 'Chiifu' clone KBrB090M17, complete sequence.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_009148050.10.0PREDICTED: GATA transcription factor 11-like
RefseqXP_009148049.10.0PREDICTED: GATA transcription factor 11-like
SwissprotQ6DBP81e-138GAT11_ARATH; GATA transcription factor 11
TrEMBLM4DQ720.0M4DQ72_BRARP; Uncharacterized protein
STRINGBra018665.1-P0.0(Brassica rapa)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM16812589
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G08010.21e-120GATA transcription factor 11